Structure of PDB 2uxb Chain L

Receptor sequence

>2uxbL (length=124) Species: 300852 (Thermus thermophilus HB8)

PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPKEA

3D structure

• PDB: 2uxb Structures of tRNAs with an expanded anticodon loop in the decoding center of the 30S ribosomal subunit.
• Chain: L
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	P5 T6 N8 Q9 L10 R12 R15 E16 K17 K23 K28 G29 P31 F32 R33 R34 K46 K47 N49 S50 L52 R53 K54 K57 T61 Y69 G72 E73 R86 G87 K91 D92 P94 R97 R113 K114 K115 S116 R117 S118 K119 Y120 K123 K124	P1 T2 N4 Q5 L6 R8 R11 E12 K13 K19 K24 G25 P27 F28 R29 R30 K42 K43 N45 S46 L48 R49 K50 K53 T57 Y65 G68 E69 R82 G83 K87 D88 P90 R93 R109 K110 K111 S112 R113 S114 K115 Y116 K119 K120

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:2uxb, PDBe:2uxb, PDBj:2uxb
• PDBsum: 2uxb
• PubMed: 17416634
• UniProt: Q5SHN3|RS12_THET8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)