Structure of PDB 2rcr Chain L

Receptor sequence

>2rcrL (length=278) Species: 1063 (Cereibacter sphaeroides)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGG

3D structure

• PDB: 2rcr Structure of the membrane-bound protein photosynthetic reaction center from Rhodobacter sphaeroides.
• Chain: L
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	L	F97 Y128 W156 V157 Y162 H168 H173 I177 F180 M248	F97 Y128 W156 V157 Y162 H168 H173 I177 F180 M248
BS02	BCL	L	Y128 F146 H153	Y128 F146 H153
BS03	BPH	L	A42 F97 E104 F121 Y148 I150	A42 F97 E104 F121 Y148 I150
BS04	UQ	L	L185 L193 E212 F216 S223 I224 I229	L185 L193 E212 F216 S223 I224 I229
BS05	FE	L	H190 H230	H190 H230
BS06	BCL	L	H168 M174 I177 S178	H168 M174 I177 S178
BS07	BPH	L	F181 L185 L189	F181 L185 L189

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:2rcr, PDBe:2rcr, PDBj:2rcr
• PDBsum: 2rcr
• PubMed: 2036404
• UniProt: P0C0Y8|RCEL_CERSP Reaction center protein L chain (Gene Name=pufL)