Structure of PDB 2jiy Chain L

Receptor sequence

>2jiyL (length=281) Species: 1063 (Cereibacter sphaeroides)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

• PDB: 2jiy Structural Responses to Cavity-Creating Mutations in an Integral Membrane Protein.
• Chain: L
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	L	H168 M174 I177 S178 T182	H168 M174 I177 S178 T182
BS02	BCL	L	F97 A124 I125 V157 S158 T160 Y162 F167 H168 H173 I177 F180 S244 M248	F97 A124 I125 V157 S158 T160 Y162 F167 H168 H173 I177 F180 S244 M248
BS03	BCL	L	I46 Y128 L131 F146 I150 W151 H153 L154	I46 Y128 L131 F146 I150 W151 H153 L154
BS04	BPH	L	W100 E104 A120 F121 A124 Y148 G149 H153 V241	W100 E104 A120 F121 A124 Y148 G149 H153 V241
BS05	U10	L	T182 L189 H190 L193 E212 F216 S223 I224 G225 T226 I229	T182 L189 H190 L193 E212 F216 S223 I224 G225 T226 I229
BS06	FE	L	H190 H230	H190 H230
BS07	U10	L	F29 W100	F29 W100

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:2jiy, PDBe:2jiy, PDBj:2jiy
• PDBsum: 2jiy
• PubMed: 17711306
• UniProt: P0C0Y8|RCEL_CERSP Reaction center protein L chain (Gene Name=pufL)