Structure of PDB 2jbl Chain L

Receptor sequence

>2jblL (length=273) Species: 1079 (Blastochloris viridis) [Search protein sequence]

ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIG
YAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISW
MLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGI
LSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANP
GDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIA
SGPFWTRGWPEWWGWWLDIPFWS

3D structure

PDB

2jbl A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome Bc(1) Complex.

Chain

Resolution

2.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCB	L	F97 P124 M127 F128 V157 N158 F160 Y162 W167 H168 H173 S176 V177 F181 F241 G244 T248	F97 P124 M127 F128 V157 N158 F160 Y162 W167 H168 H173 S176 V177 F181 F241 G244 T248
BS02	BCB	L	F146 I150 H153 L154 V157	F146 I150 H153 L154 V157
BS03	BPB	L	I42 I49 W100 E104 F121 P124 Y148 G149 I150 H153 A237	I42 I49 W100 E104 F121 P124 Y148 G149 I150 H153 A237
BS04	SMA	L	L189 H190 L193 E212 N213 F216 Y222 S223 G225 A226 I229	L189 H190 L193 E212 N213 F216 Y222 S223 G225 A226 I229	PDBbind-CN: -logKd/Ki=5.89,IC50=1.3uM
BS05	BCB	L	M174 V177 S178 F181 V182	M174 V177 S178 F181 V182
BS06	BPB	L	F181 M185	F181 M185
BS07	FE	L	H190 H230	H190 H230
BS08	MQ7	L	Y29 G35 W100	Y29 G35 W100

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2jbl, PDBe:2jbl, PDBj:2jbl
PDBsum	2jbl
PubMed	17337272
UniProt	P06009\|RCEL_BLAVI Reaction center protein L chain (Gene Name=pufL)

[Back to BioLiP]