Structure of PDB 2j8c Chain L

Receptor sequence

>2j8cL (length=281) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

PDB

2j8c Ph Modulates the Quinone Position in the Photosynthetic Reaction Center from Rhodobacter Sphaeroides in the Neutral and Charge Separated States.

Chain

Resolution

1.87 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	L	L131 F146 I150 H153 L154	L131 F146 I150 H153 L154
BS02	BPH	L	I49 A93 W100 E104 I117 F121 A124 Y148 H153 V241	I49 A93 W100 E104 I117 F121 A124 Y148 H153 V241
BS03	U10	L	L189 H190 L193 E212 D213 F216 S223 I224 G225 T226 I229	L189 H190 L193 E212 D213 F216 S223 I224 G225 T226 I229
BS04	BCL	L	F97 A124 I125 L131 V157 T160 Y162 F167 H168 H173 I177 F180 S244 M248	F97 A124 I125 L131 V157 T160 Y162 F167 H168 H173 I177 F180 S244 M248
BS05	BCL	L	H168 M174 I177 S178 T182	H168 M174 I177 S178 T182
BS06	FE	L	H190 H230	H190 H230
BS07	BPH	L	F181 L185 L189	F181 L185 L189
BS08	U10	L	F29 W100 R103	F29 W100 R103

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2j8c, PDBe:2j8c, PDBj:2j8c
PDBsum	2j8c
PubMed	17570397
UniProt	P0C0Y8\|RCEL_CERSP Reaction center protein L chain (Gene Name=pufL)

[Back to BioLiP]