Structure of PDB 2i2x Chain L

Receptor sequence

>2i2xL (length=258) Species: 2208 (Methanosarcina barkeri)

MLDFTEASLKKVLTRYNVALEKALTPEEAAEELYPKDELIYPIAKAIFEG
EEDDVVEGLQAAIEAGKDPIDLIDDALMVGMGVVIRLYDEGVIFLPNVMM
SADAMLEGIEYCKENSGATPKTKGTVVCHVAEGDVHDIGKNIVTALLRAN
GYNVVDLGRDVPAEEVLAAVQKEKPIMLTGTALMTTTMYAFKEVNDMLLE
NGIKIPFACGGGAVNQDFVSQFALGVYGEEAADAPKIADAIIAGTTDVTE
LREKFHKH

3D structure

• PDB: 2i2x Insight into the mechanism of biological methanol activation based on the crystal structure of the methanol-cobalamin methyltransferase complex
• Chain: L
• Resolution: 2.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D134 H136 T187
• Catalytic site (residue number reindexed from 1): D134 H136 T187
• Enzyme Commision number: 2.1.1.90: methanol--corrinoid protein Co-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	B13	L	G133 D134 V135 H136 D137 I138 G139 V143 T179 T181 L183 M184 T185 A208 G210 G211 G212 G228 E229 E230 A231	G133 D134 V135 H136 D137 I138 G139 V143 T179 T181 L183 M184 T185 A208 G210 G211 G212 G228 E229 E230 A231

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008168 methyltransferase activity
• GO:0008705 methionine synthase activity
• GO:0031419 cobalamin binding
• GO:0046872 metal ion binding
• GO:0050897 cobalt ion binding

Biological Process

• GO:0009086 methionine biosynthetic process
• GO:0015948 methanogenesis
• GO:0046653 tetrahydrofolate metabolic process
• GO:0050667 homocysteine metabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:2i2x, PDBe:2i2x, PDBj:2i2x
• PDBsum: 2i2x
• PubMed: 17142327
• UniProt: Q46EH4|MTAC_METBF Methanol--corrinoid protein (Gene Name=mtaC)