Structure of PDB 2gc7 Chain L

Receptor sequence

>2gc7L (length=147) Species: 266 (Paracoccus denitrificans)

APQFFNIIDGSPLNFDDAMEEGRDTEAVKHFLETGENVYNEDPEILPEAE
ELYAGMCSGCHGHYAEGKIGPGLNDAYWTYPGNETDVGLFSTLYGGATGQ
MGPMWGSLTLDEMLRTMAWVRHLYTGDPKDASWLTDEQKAGFTPFQP

3D structure

• PDB: 2gc7 Structure of an electron transfer complex: methylamine dehydrogenase, amicyanin and cytochrome c551i.
• Chain: L
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	L	M56 C57 C60 H61 P71 L73 W78 T79 Y80 N83 A97 T98 Q100 M101	M56 C57 C60 H61 P71 L73 W78 T79 Y80 N83 A97 T98 Q100 M101

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015945 methanol metabolic process

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:2gc7, PDBe:2gc7, PDBj:2gc7
• PDBsum: 2gc7
• UniProt: P29899|CYCL_PARDE Cytochrome c-L (Gene Name=moxG)