Structure of PDB 1yst Chain L

Receptor sequence

>1ystL (length=273) Species: 1063 (Cereibacter sphaeroides)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWA

3D structure

• PDB: 1yst Structure of the photochemical reaction centre of a spheroidene-containing purple-bacterium, Rhodobacter sphaeroides Y, at 3 A resolution.
• Chain: L
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	L	F97 A124 A127 L131 F167 H173 I177 F180 S244 C247 M248	F97 A124 A127 L131 F167 H173 I177 F180 S244 C247 M248
BS02	BCL	L	F146 H153 L154	F146 H153 L154
BS03	BPH	L	A42 A93 W100 E104 F121 Y148 V241	A42 A93 W100 E104 F121 Y148 V241
BS04	U10	L	H190 L193 E212 D213 F216 S223 I224 G225 I229	H190 L193 E212 D213 F216 S223 I224 G225 I229
BS05	MN	L	H190 H230	H190 H230
BS06	BCL	L	M174 I177 S178 T182	M174 I177 S178 T182
BS07	BCL	L	H168 F181	H168 F181
BS08	BPH	L	F181 L189	F181 L189

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:1yst, PDBe:1yst, PDBj:1yst
• PDBsum: 1yst
• PubMed: 15299304
• UniProt: P0C0Y8|RCEL_CERSP Reaction center protein L chain (Gene Name=pufL)