Structure of PDB 1r2c Chain L

Receptor sequence

>1r2cL (length=273) Species: 1079 (Blastochloris viridis) [Search protein sequence]

ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIG
YAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISW
MLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGI
LSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANP
GDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIA
SGPFWTRGWPEWWGWWLDIPFWS

3D structure

PDB

1r2c Time-resolved crystallographic studies of light-induced structural changes in the photosynthetic reaction center.

Chain

Resolution

2.86 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCB	L	F97 L131 V157 N158 F160 Y162 W167 H168 H173 S176 V177 F181 F241 G244 T248	F97 L131 V157 N158 F160 Y162 W167 H168 H173 S176 V177 F181 F241 G244 T248
BS02	BCB	L	F128 F146 I150 H153 L154 V157	F128 F146 I150 H153 L154 V157
BS03	BPB	L	I42 F97 W100 E104 A120 F121 Y148 A237 F241	I42 F97 W100 E104 A120 F121 Y148 A237 F241
BS04	UQ2	L	H190 L193 E212 N213 F216 Y222 S223 I224 G225 A226 I229	H190 L193 E212 N213 F216 Y222 S223 I224 G225 A226 I229
BS05	FE2	L	H190 H230	H190 H230
BS06	BCB	L	M174 V177 S178 F181 V182 M185	M174 V177 S178 F181 V182 M185
BS07	BPB	L	F181 M185 L189	F181 M185 L189
BS08	MQ7	L	Y29 G35 I39 W100	Y29 G35 I39 W100

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1r2c, PDBe:1r2c, PDBj:1r2c
PDBsum	1r2c
PubMed	15073325
UniProt	P06009\|RCEL_BLAVI Reaction center protein L chain (Gene Name=pufL)

[Back to BioLiP]