Structure of PDB 1pst Chain L

Receptor sequence

>1pstL (length=266) Species: 1063 (Cereibacter sphaeroides)

FERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIAWSAV
LQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSWALRE
VEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGIWTHL
DWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANPEKGK
EMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMIITGTI
WFDQWVDWWQWWVKLP

3D structure

• PDB: 1pst Crystallographic analyses of site-directed mutants of the photosynthetic reaction center from Rhodobacter sphaeroides.
• Chain: L
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	L	F97 A124 A127 Y128 L131 G161 F167 H168 H173 I177 F180 S244 M248	F93 A120 A123 Y124 L127 G157 F163 H164 H169 I173 F176 S240 M244
BS02	BCL	L	Y128 L131 F146 H153 L154	Y124 L127 F142 H149 L150
BS03	BPH	L	E104 A120 F121 A124 Y148 H153 V241	E100 A116 F117 A120 Y144 H149 V237
BS04	U10	L	H190 E212 F216 V220 S223 I224 T226 I229	H186 E208 F212 V216 S219 I220 T222 I225
BS05	FE	L	H190 H230	H186 H226
BS06	BCL	L	M174 I177 S178 T182	M170 I173 S174 T178
BS07	BPH	L	F181 L185 L189	F177 L181 L185
BS08	U10	L	G35 W100 R103	G31 W96 R99

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:1pst, PDBe:1pst, PDBj:1pst
• PDBsum: 1pst
• PubMed: 8161514
• UniProt: P0C0Y8|RCEL_CERSP Reaction center protein L chain (Gene Name=pufL)