Structure of PDB 1p4b Chain L |
>1p4bL (length=110) Species: 10090 (Mus musculus) [Search protein sequence] |
ADAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYASWVQEKPDHLFTGL IGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWV FGGGTKLTVL |
|
PDB | 1p4b Directed in Vitro Evolution and Crystallographic Analysis of a Peptide-binding Single Chain Antibody Fragment (scFv) with Low Picomolar Affinity. |
Chain | L |
Resolution | 2.35 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
L |
Y40 N69 W109 |
Y35 N56 W94 |
|
|
|