Structure of PDB 1jb0 Chain L

Receptor sequence

>1jb0L (length=151) Species: 32046 (Synechococcus elongatus) [Search protein sequence]

LVKPYNGDPFVGHLSTPISDSGLVKTFIGNLPAYRQGLSPILRGLEVGMA
HGYFLIGPWVKLGPLRDSDVANLGGLISGIALILVATACLAAYGLVSFQK
GGSSSDPLKTSEGWSQFTAGFFVGAMGSAFVAFFLLENFLVVDGIMTGLF
N

3D structure

PDB

1jb0 Three-dimensional Structure of Cyanobacterial Photosystem I at 2.5 A Resolution

Chain

Resolution

2.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	L	L17 T19 I21 S22	L14 T16 I18 S19
BS02	CLA	L	P61 W62 L65 P67	P58 W59 L62 P64
BS03	CLA	L	W62 P67 S81	W59 P64 S78
BS04	CA	L	P67 D70	P64 D67
BS05	CLA	L	F30 N33 R38 E49 M52	F27 N30 R35 E46 M49
BS06	CLA	L	F30 P35 A36 V50 H54 F57	F27 P32 A33 V47 H51 F54
BS07	CLA	L	Y56 F57 G60 P61 K64 L138 L139 F142	Y53 F54 G57 P58 K61 L135 L136 F139

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1jb0, PDBe:1jb0, PDBj:1jb0
PDBsum	1jb0
PubMed	11418848
UniProt	Q8DGB4\|PSAL_THEVB Photosystem I reaction center subunit XI (Gene Name=psaL)

[Back to BioLiP]