Structure of PDB 1i94 Chain L

Receptor sequence
>1i94L (length=131) Species: 274 (Thermus thermophilus) [Search protein sequence]
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPKEAAKTAAKK
3D structure
PDB1i94 Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
ChainL
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L P5 E16 A30 P31 R34 N49 S50 G72 E73 G87 G95 R113 K114 K115 S116 S118 T122 K123 P1 E12 A26 P27 R30 N45 S46 G68 E69 G83 G91 R109 K110 K111 S112 S114 T118 K119
BS02 MG L K124 P125 K120 P121
BS03 MG L F32 R33 F28 R29
BS04 MG L T131 A132 A133 T127 A128 A129
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1i94, PDBe:1i94, PDBj:1i94
PDBsum1i94
PubMed11296217
UniProtQ5SHN3|RS12_THET8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)

[Back to BioLiP]