Structure of PDB 1h0h Chain L

Receptor sequence

>1h0hL (length=214) Species: 879 (Megalodesulfovibrio gigas)

SKGFFVDTTRCTACRGCQVACKQWHGNPATPTENTGFHQNPPDFNFHTYK
LVRMHEQEIDGRIDWLFFPDQCRHCIAPPCKATADMEDESAIIHDDATGC
VLFTPKTKDLEDYESVISACPYDVPRKVAESNQMAKCDMCIDRITNGLRP
ACVTSCPTGAMNFGDLSEMEAMASARLAEIKAAYSDAKLCDPDDVRVIFL
TAHNPKLYHEYAVA

3D structure

• PDB: 1h0h Gene Sequence and the 1.8 A Crystal Structure of the Tungsten-Containing Formate Dehydrogenase from Desulfovibrio Gigas
• Chain: L
• Resolution: 1.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	L	C11 T12 A13 C14 R15 C17 C156 P157 A160	C11 T12 A13 C14 R15 C17 C156 P157 A160
BS02	SF4	L	F4 C21 H25 K50 Q71 C137 D138 M139 C140 P150 C152	F4 C21 H25 K50 Q71 C137 D138 M139 C140 P150 C152
BS03	SF4	L	C72 R73 C75 P79 C80 V101 C120 P125 K136	C72 R73 C75 P79 C80 V101 C120 P125 K136

Gene Ontology

Molecular Function

• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:1h0h, PDBe:1h0h, PDBj:1h0h
• PDBsum: 1h0h
• PubMed: 12220497
• UniProt: Q8GC87|FDHB_MEGG1 Formate dehydrogenase subunit beta (Gene Name=fdhB)