Structure of PDB 1gqm Chain L

Receptor sequence

>1gqmL (length=86) Species: 9606 (Homo sapiens) [Search protein sequence]

TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDK
AVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHY

3D structure

PDB

1gqm The Structure of S100A12 in a Hexameric Form and its Proposed Role in Receptor Signalling

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CA	L	Q58 Q64	Q58 Q64
BS02	CA	L	S18 K21 H23 T26 E31	S18 K21 H23 T26 E31
BS03	CA	L	D61 N63 D65 Q67 E72	D61 N63 D65 Q67 E72

Gene Ontology

	Molecular Function
GO:0005507	copper ion binding
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0042802	identical protein binding
GO:0046872	metal ion binding
GO:0048306	calcium-dependent protein binding
GO:0050786	RAGE receptor binding

	Biological Process
GO:0002548	monocyte chemotaxis
GO:0006805	xenobiotic metabolic process
GO:0006954	inflammatory response
GO:0030593	neutrophil chemotaxis
GO:0031640	killing of cells of another organism
GO:0042742	defense response to bacterium
GO:0043123	positive regulation of canonical NF-kappaB signal transduction
GO:0043406	positive regulation of MAP kinase activity
GO:0043542	endothelial cell migration
GO:0045087	innate immune response
GO:0045576	mast cell activation
GO:0050729	positive regulation of inflammatory response
GO:0050832	defense response to fungus
GO:0051092	positive regulation of NF-kappaB transcription factor activity
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide

External links

PDB	RCSB:1gqm, PDBe:1gqm, PDBj:1gqm
PDBsum	1gqm
PubMed	11856825
UniProt	P80511\|S10AC_HUMAN Protein S100-A12 (Gene Name=S100A12)