Structure of PDB 1fjg Chain L

Receptor sequence

>1fjgL (length=125) Species: 274 (Thermus thermophilus)

PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPKEAA

3D structure

• PDB: 1fjg Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
• Chain: L
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L	P5 N8 Q9 L10 R12 K13 R15 E16 K17 K20 K21 K23 K28 A30 P31 F32 R33 R34 K46 K47 N49 S50 A51 R53 K54 K57 T61 Y69 G72 E73 L84 R86 G87 R89 K91 D92 P94 R97 V104 R113 K114 K115 S116 R117 S118 K119 K123 K124	P1 N4 Q5 L6 R8 K9 R11 E12 K13 K16 K17 K19 K24 A26 P27 F28 R29 R30 K42 K43 N45 S46 A47 R49 K50 K53 T57 Y65 G68 E69 L80 R82 G83 R85 K87 D88 P90 R93 V100 R109 K110 K111 S112 R113 S114 K115 K119 K120
BS02	SRY	L	K46 K47 K91	K42 K43 K87

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1fjg, PDBe:1fjg, PDBj:1fjg
• PDBsum: 1fjg
• PubMed: 11014183
• UniProt: Q5SHN3|RS12_THET8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)