Structure of PDB 1dxr Chain L

Receptor sequence

>1dxrL (length=273) Species: 1079 (Blastochloris viridis) [Search protein sequence]

ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIG
YAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISW
MLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGI
LSHLDWVNNFGYQYLNWFYNPGHMSSVSFLFVNAMALGLHGGLILSVANP
GDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIA
SGPFWTRGWPEWWGWWLDIPFWS

3D structure

PDB

1dxr Structural basis of the drastically increased initial electron transfer rate in the reaction center from a Rhodopseudomonas viridis mutant described at 2.00-A resolution.

Chain

Resolution

2.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCB	L	F97 M127 F128 V157 F160 Y162 W167 F168 H173 S176 V177 F241 G244 T248	F97 M127 F128 V157 F160 Y162 W167 F168 H173 S176 V177 F241 G244 T248
BS02	BCB	L	F146 I150 H153 L154 V157	F146 I150 H153 L154 V157
BS03	BPB	L	I42 I49 W100 E104 A120 F121 P124 Y148 H153 F241	I42 I49 W100 E104 A120 F121 P124 Y148 H153 F241
BS04	FE2	L	H190 H230	H190 H230
BS05	MQ9	L	Y29 I39 F43 W100	Y29 I39 F43 W100
BS06	MST	L	L189 H190 E212 F216 Y222 S223 I224 G225 I229	L189 H190 E212 F216 Y222 S223 I224 G225 I229
BS07	BCB	L	F168 M174 V177 F181 V182 V220	F168 M174 V177 F181 V182 V220
BS08	BPB	L	F181 M185 L189	F181 M185 L189

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1dxr, PDBe:1dxr, PDBj:1dxr
PDBsum	1dxr
PubMed	11005826
UniProt	P06009\|RCEL_BLAVI Reaction center protein L chain (Gene Name=pufL)

[Back to BioLiP]