Structure of PDB 1dv3 Chain L

Receptor sequence

>1dv3L (length=281) Species: 1063 (Cereibacter sphaeroides)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

• PDB: 1dv3 Determination of the binding sites of the proton transfer inhibitors Cd2+ and Zn2+ in bacterial reaction centers.
• Chain: L
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	L	H168 M174 I177 S178 T182 L185	H168 M174 I177 S178 T182 L185
BS02	BCL	L	F97 A124 I125 A127 L131 V157 T160 F167 H168 H173 I177 F180 S244 A245 M248	F97 A124 I125 A127 L131 V157 T160 F167 H168 H173 I177 F180 S244 A245 M248
BS03	BPH	L	W100 E104 F121 F123 A124 Y148 V241	W100 E104 F121 F123 A124 Y148 V241
BS04	U10	L	L189 H190 L193 E212 F216 S223 I224 G225 T226 I229	L189 H190 L193 E212 F216 S223 I224 G225 T226 I229
BS05	FE2	L	H190 H230	H190 H230
BS06	BCL	L	F146 H153 L154	F146 H153 L154
BS07	BPH	L	F181 L185 L189	F181 L185 L189

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:1dv3, PDBe:1dv3, PDBj:1dv3
• PDBsum: 1dv3
• PubMed: 10677497
• UniProt: P0C0Y8|RCEL_CERSP Reaction center protein L chain (Gene Name=pufL)