Structure of PDB 1bos Chain L

Receptor sequence
>1bosL (length=69) Species: 12371 (Phage h30) [Search protein sequence]
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTV
TIKTNACHNGGGFSEVIFR
3D structure
PDB1bos Structure of the shiga-like toxin I B-pentamer complexed with an analogue of its receptor Gb3.
ChainL
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GLA L D3218 W3234 D18 W34
BS02 GAL L T3254 N3255 G3262 T54 N55 G62
BS03 GLA L N3232 R3233 F3263 N32 R33 F63
BS04 GLA L R3233 W3234 N3235 R33 W34 N35
BS05 GAL L T3221 E3228 F3230 T21 E28 F30
Gene Ontology
Biological Process
GO:0019836 hemolysis by symbiont of host erythrocytes
GO:0098676 modulation of host virulence by virus
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1bos, PDBe:1bos, PDBj:1bos
PDBsum1bos
PubMed9485303
UniProtP69179|STXB_BPH19 Shiga-like toxin 1 subunit B (Gene Name=stxB)

[Back to BioLiP]