Structure of PDB 7ap5 Chain KKK

Receptor sequence

>7ap5KKK (length=164) Species: 2283151 (Nostoc sp. WR13)

MKSVVTTVIAAADAAGRFPSSSDLESVQGSIQRAAARLEAAEKLAGNIDA
VATEAYNACIKKYPYLNNAGEANSTDTFKAKCARDIKHYLRLIQYCLVVG
GTGPLDEWGIAGQREVYRALGLPTAPYVEALSFARNRGCAPRDMSAQALT
EYNALLDYAINSLS

3D structure

• PDB: 7ap5 The crystal stacks of hexameric assemblies of phycoerythrin from cyanobacterium Nostoc sp. WR13 resemble rods of phycobilisome
• Chain: KKK
• Resolution: 2.131 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PEB	KKK	A72 N73 F78 K81 C82 R84 D85 H88 W108 V116 Y117 L122 P123 P126 Y127	A72 N73 F78 K81 C82 R84 D85 H88 W108 V116 Y117 L122 P123 P126 Y127
BS02	PEB	KKK	N47 V51 E54 R137 C139 R142 D143	N47 V51 E54 R137 C139 R142 D143
BS03	PEB	KKK	L24 Q28	L24 Q28
BS04	PEB	KKK	R33 Q147	R33 Q147

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 12:16:48 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7ap5', asym_id = 'KKK', title = 'The crystal stacks of hexameric assemblies of ph...um Nostoc sp. WR13 resemble rods of phycobilisome'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7ap5', asym_id='KKK', title='The crystal stacks of hexameric assemblies of ph...um Nostoc sp. WR13 resemble rods of phycobilisome')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0015979,0030089', uniprot = '', pdbid = '7ap5', asym_id = 'KKK'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979,0030089', uniprot='', pdbid='7ap5', asym_id='KKK')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>