Structure of PDB 7m2v Chain KK |
>7m2vKK (length=144) Species: 12881 (Satellite tobacco mosaic virus) [Search protein sequence] |
NSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSLFSANF RTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASN INTRASVGYRIPTNLRQNTVAADNVCEVRSNCRQVALVISCCFN |
|
PDB | 7m2v Structures of additional crystal forms of Satellite tobacco mosaic virus grown from a variety of salts. |
Chain | KK |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
KK |
P35 T36 W37 V38 |
P20 T21 W22 V23 |
|
|
|
|