Structure of PDB 7lhd Chain KJ |
>7lhdKJ (length=132) Species: 39803 (Qubevirus durum) [Search protein sequence] |
AKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTV SVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYS TDEERAFVRTELAALLASPLLIDAIDQLNPAY |
|
PDB | 7lhd Structural Assembly of Q beta Virion and Its Diverse Forms of Virus-like Particles. |
Chain | KJ |
Resolution | 4.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
KJ |
S56 R57 N58 R59 |
S56 R57 N58 R59 |
|
|
|
|