Structure of PDB 6bok Chain KB

Receptor sequence

>6bokKB (length=181) Species: 262724 (Thermus thermophilus HB27)

PLDLALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 6bok Conformational Control of Translation Termination on the 70S Ribosome.
• Chain: KB
• Resolution: 3.55 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	KB	K36 N40 G42 E45 K47 T71 A73 K74 N79 F80 I88 S124 D126 R128 N130 N132 L135 G154 D156	K35 N39 G41 E44 K46 T70 A72 K73 N78 F79 I87 S123 D125 R127 N129 N131 L134 G153 D155
BS02	rna	KB	N27 W29 E30 Q66 K67 A69 V70 V92 T93 R95 R96 R98	N26 W28 E29 Q65 K66 A68 V69 V91 T92 R94 R95 R97
BS03	rna	KB	S76 I77 S78	S75 I76 S77

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6bok, PDBe:6bok, PDBj:6bok
• PDBsum: 6bok
• PubMed: 29731232
• UniProt: Q72I16|RL5_THET2 Large ribosomal subunit protein uL5 (Gene Name=rplE)