Structure of PDB 6b4v Chain KB

Receptor sequence

>6b4vKB (length=202) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]

MYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTASTKTRG
EVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLPKKV
RKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSESVL
LVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNR
IG

3D structure

PDB

6b4v Mechanism of Inhibition of Translation Termination by Blasticidin S.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	KB	H31 W34 R38 Q40 L41 K43 R44 R45 R46 T48 A49 T51 K52 T53 R54 V57 A58 Y59 S60 G61 R62 Q67 K68 H69 G71 R72 A73 R74 H75 G76 P81 I82 F83 V84 G85 V89 F90 P92 R95 T100 P102 K103 K104 V105 R106 K108 G134 K135 T136 K137 R165 R168 N169 P171 E179 G180 Y184 R205	H26 W29 R33 Q35 L36 K38 R39 R40 R41 T43 A44 T46 K47 T48 R49 V52 A53 Y54 S55 G56 R57 Q62 K63 H64 G66 R67 A68 R69 H70 G71 P76 I77 F78 V79 G80 V84 F85 P87 R90 T95 P97 K98 K99 V100 R101 K103 G129 K130 T131 K132 R160 R163 N164 P166 E174 G175 Y179 R200
BS02	MG	KB	K103 K104	K98 K99

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6b4v, PDBe:6b4v, PDBj:6b4v
PDBsum	6b4v
PubMed	29366636
UniProt	Q72I05\|RL4_THET2 Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]