Structure of PDB 4wsd Chain K8

Receptor sequence
>4wsdK8 (length=67) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
LSEVRKQLEEARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKIRD
LKRQIARLLTVLNEKRR
3D structure
PDB4wsd Structural insights into the translational infidelity mechanism.
ChainK8
Resolution2.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K8 L3 R7 L10 R14 Q46 N47 H48 R51 K54 R55 A58 R59 L61 N65 R69 L1 R5 L8 R12 Q44 N45 H46 R49 K52 R53 A56 R57 L59 N63 R67
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wsd, PDBe:4wsd, PDBj:4wsd
PDBsum4wsd
PubMed26037619
UniProtQ5SHP6|RL29_THET8 Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]