Structure of PDB 7r81 Chain K2

Receptor sequence

>7r81K2 (length=174) Species: 5141 (Neurospora crassa) [Search protein sequence]

APRSYSKTAKVPRRPFEAARLDSELKLVGEYGLRNKREVWRVLLTLSKIR
RAARQLLTLDEKDPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKAED
FLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDSQ
KHIDFALTSPFGGGRPGRVRRKKA

3D structure

PDB

7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K2	A2 P3 R4 S5 Y6 S7 K8 T9 V12 R14 R15 P16 F17 R35 N36 K37 R38 R42 R52 R55 E70 R76 R77 R80 K118 S119 H122 R124 V125 Q129 R130 H131 Q137 V139 N140 V141 S143 F144 V145 R147 S150 R166 G168 R169 V170 R171 K174	A1 P2 R3 S4 Y5 S6 K7 T8 V11 R13 R14 P15 F16 R34 N35 K36 R37 R41 R51 R54 E69 R75 R76 R79 K117 S118 H121 R123 V124 Q128 R129 H130 Q136 V138 N139 V140 S142 F143 V144 R146 S149 R165 G167 R168 V169 R170 K173

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:0043226	organelle
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7r81, PDBe:7r81, PDBj:7r81
PDBsum	7r81
PubMed	34815343
UniProt	Q7SDY7

[Back to BioLiP]