Structure of PDB 6tcl Chain K2

Receptor sequence
>6tclK2 (length=73) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence]
ATTPLEWSPTVGIIMVIANVIAITFGRQTIKYPSAEPALPSAKFFGGFGA
PALLATTAFGHILGVGLVLGLHN
3D structure
PDB6tcl Distinct structural modulation of photosystem I and lipid environment stabilizes its tetrameric assembly.
ChainK2
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K2 W16 M24 W7 M15
BS02 CLA K2 T11 L78 T2 L69
BS03 CLA K2 F34 T38 F25 T29
BS04 CLA K2 L76 G79 L67 G70
BS05 CLA K2 I32 R36 F53 F54 G55 L62 T66 I23 R27 F44 F45 G46 L53 T57
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0016020 membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tcl, PDBe:6tcl, PDBj:6tcl
PDBsum6tcl
PubMed32170279
UniProtP58583|PSAK1_NOSS1 Photosystem I reaction center subunit PsaK 1 (Gene Name=psaK1)

[Back to BioLiP]