Structure of PDB 8wql Chain K1

Receptor sequence
>8wqlK1 (length=36) Species: 153964 (Arthrospira sp. FACHB-439) [Search protein sequence]
KLPEAYSIFSPVVDILPVIPVFFLLLAFVWQAAVGF
3D structure
PDB8wql Structure of in situ PBS-PSII supercomplex at 3.5 Angstroms resolution.
ChainK1
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K1 P28 L32 P20 L24
BS02 CLA K1 F31 F36 W38 Q39 F23 F28 W30 Q31
BS03 CA K1 F17 S18 P19 V20 V21 D22 F9 S10 P11 V12 V13 D14
External links