Structure of PDB 8rct Chain K1

Receptor sequence

>8rctK1 (length=115) Species: 562 (Escherichia coli)

QVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQ
VAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVT
PIPHNGCRPPKKRRV

3D structure

• PDB: 8rct Transient disome complex formation in native polysomes during ongoing protein synthesis captured by cryo-EM.
• Chain: K1
• Resolution: 5.32 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K1	H22 N28 N29 I31 T33 G39 N40 A41 W44 T46 G48 G49 R53 G54 S55 K57 K87 P115 I116 P117 H118 N119 C121 R122 P123 P124 K125 R127 R128 V129	H8 N14 N15 I17 T19 G25 N26 A27 W30 T32 G34 G35 R39 G40 S41 K43 K73 P101 I102 P103 H104 N105 C107 R108 P109 P110 K111 R113 R114 V115

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8rct, PDBe:8rct, PDBj:8rct
• PDBsum: 8rct
• PubMed: 38409277
• UniProt: P0A7R9|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)