Structure of PDB 6gzx Chain K1

Receptor sequence

>6gzxK1 (length=150) Species: 300852 (Thermus thermophilus HB8)

MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRR
FEGGRSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELL
VRAGLLKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVLLEA

3D structure

• PDB: 6gzx Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
• Chain: K1
• Resolution: 4.57 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K1	L3 S4 L6 P8 N9 K14 R16 K17 R18 V19 G20 R21 G22 H27 K29 T32 R33 H35 K36 G37 Q38 S40 R41 S42 G43 K46 D47 R49 R50 F51 E52 G53 G54 R55 S56 M60 R61 L62 P63 K64 R65 G66 Q68 Q70 V71 P72 G73 E74 I75 K76 G82 N84 K86 A89 A103 G104 L105 K107 K113 L115 G116 E117 S131 S133	L3 S4 L6 P8 N9 K14 R16 K17 R18 V19 G20 R21 G22 H27 K29 T32 R33 H35 K36 G37 Q38 S40 R41 S42 G43 K46 D47 R49 R50 F51 E52 G53 G54 R55 S56 M60 R61 L62 P63 K64 R65 G66 Q68 Q70 V71 P72 G73 E74 I75 K76 G82 N84 K86 A89 A103 G104 L105 K107 K113 L115 G116 E117 S131 S133

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gzx, PDBe:6gzx, PDBj:6gzx
• PDBsum: 6gzx
• PubMed: 30301898
• UniProt: Q5SHQ7|RL15_THET8 Large ribosomal subunit protein uL15 (Gene Name=rplO)