Structure of PDB 9bju Chain K |
>9bjuK (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] |
MYVKLISSDGHEFIVKREHALTSGTIKAMLSTNEVNFREIPSHVLSKVCM YFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC |
|
PDB | 9bju Potency-enhanced peptidomimetic VHL ligands with improved oral bioavailability |
Chain | K |
Resolution | 2.47 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
TFA |
K |
V19 K20 |
V3 K4 |
|
|
|