Structure of PDB 8yti Chain K

Receptor sequence
>8ytiK (length=106) Species: 9606 (Homo sapiens) [Search protein sequence]
PATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR
IRGERA
3D structure
PDB8yti Linker Histones Associate Heterogeneously with Nucleosomes in the Condensed State
ChainK
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna K G33 G34 V35 R40 Y41 R42 P43 T45 R63 R72 R83 F84 Q85 S86 R116 T118 M120 G4 G5 V6 R11 Y12 R13 P14 T16 R34 R43 R54 F55 Q56 S57 R87 T89 M91
BS02 dna K K37 H39 R40 Y41 G44 V46 R49 K64 L65 R69 R83 K8 H10 R11 Y12 G15 V17 R20 K35 L36 R40 R54
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0045296 cadherin binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0010467 gene expression
GO:0032200 telomere organization
GO:0040029 epigenetic regulation of gene expression
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8yti, PDBe:8yti, PDBj:8yti
PDBsum8yti
PubMed
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]