Structure of PDB 8y36 Chain K

Receptor sequence

>8y36K (length=137) Species: 1280 (Staphylococcus aureus)

MLLPKRVKYRRQHRPKTTGRSKGGNYVTFGEFGLQATTTSWITSRQIESA
RIAMTRYMKRGGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPG
RILFEVAGVSEEVAREALRLASHKLPVKTKFVKREEL

3D structure

• PDB: 8y36 Synthetic macrolides overcoming MLS B K-resistant pathogens.
• Chain: K
• Resolution: 2.65 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	L2 L3 P4 K5 R6 K8 Y9 R11 Q12 H13 R14 K16 K22 G24 F29 W41 R45 Q46 S49 R56 H71 K76 K77 E80 V81 R82 M83 G84 A85 G86 K87 R101 R119 H123 K124 P126 K128	L2 L3 P4 K5 R6 K8 Y9 R11 Q12 H13 R14 K16 K22 G24 F29 W41 R45 Q46 S49 R56 H71 K76 K77 E80 V81 R82 M83 G84 A85 G86 K87 R101 R119 H123 K124 P126 K128
BS02	rna	K	T17 G19 T39	T17 G19 T39

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8y36, PDBe:8y36, PDBj:8y36
• PDBsum: 8y36
• PubMed: 38992047
• UniProt: Q7A080|RL16_STAAW Large ribosomal subunit protein uL16 (Gene Name=rplP)