Structure of PDB 8wm6 Chain K

Receptor sequence
>8wm6K (length=69) Species: 52970 (Rhodomonas salina) [Search protein sequence]
VPQTVAWSAKTGAVMVLSNILCIVAGRYVIQVKSGSFAGFGLPELLASTS
LGHIVGSGAILGLSYVGVL
3D structure
PDB8wm6 Growth phase-dependent reorganization of cryptophyte photosystem I antennae.
ChainK
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K P11 G75 L78 P2 G58 L61
BS02 CLA K V38 Q40 V29 Q31
BS03 CLA K I71 V72 G75 A76 G79 Y82 I54 V55 G58 A59 G62 Y65
BS04 WVN K A64 S65 S67 L68 A47 S48 S50 L51
BS05 CLA K W16 G21 M24 H70 W7 G12 M15 H53
BS06 WVN K T66 H70 T49 H53
BS07 CLA K L26 V33 L17 V24
BS08 CLA K A22 L26 V85 A13 L17 V68
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wm6, PDBe:8wm6, PDBj:8wm6
PDBsum8wm6
PubMed38734819
UniProtA6MVS9

[Back to BioLiP]