Structure of PDB 8txx Chain K

Receptor sequence

>8txxK (length=30) Species: 9606 (Homo sapiens) [Search protein sequence]

DRLLALQLQKEVDKEQNRQKGSPDEYHLRA

3D structure

PDB

8txx Cryo-EM structure of the human nucleosome core particle ubiquitylated at histone H2A K15 in complex with RNF168 (Class 3)

Chain

Resolution

3.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

2.3.2.27: RING-type E3 ubiquitin transferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	K	L448 Q452	L3 Q7

Gene Ontology

	Molecular Function
GO:0003682	chromatin binding
GO:0004842	ubiquitin-protein transferase activity
GO:0005515	protein binding
GO:0016740	transferase activity
GO:0031491	nucleosome binding
GO:0042393	histone binding
GO:0043130	ubiquitin binding
GO:0046872	metal ion binding
GO:0070530	K63-linked polyubiquitin modification-dependent protein binding
GO:0140852	histone ubiquitin ligase activity
GO:0140858	histone H2AK15 ubiquitin ligase activity

	Biological Process
GO:0006281	DNA repair
GO:0006302	double-strand break repair
GO:0006303	double-strand break repair via nonhomologous end joining
GO:0006325	chromatin organization
GO:0006511	ubiquitin-dependent protein catabolic process
GO:0006974	DNA damage response
GO:0010212	response to ionizing radiation
GO:0016567	protein ubiquitination
GO:0034244	negative regulation of transcription elongation by RNA polymerase II
GO:0036297	interstrand cross-link repair
GO:0040029	epigenetic regulation of gene expression
GO:0045190	isotype switching
GO:0045739	positive regulation of DNA repair
GO:0070534	protein K63-linked ubiquitination
GO:0097680	double-strand break repair via classical nonhomologous end joining
GO:0140861	DNA repair-dependent chromatin remodeling

External links

PDB	RCSB:8txx, PDBe:8txx, PDBj:8txx
PDBsum	8txx
PubMed	38242129
UniProt	Q8IYW5\|RN168_HUMAN E3 ubiquitin-protein ligase RNF168 (Gene Name=RNF168)