Structure of PDB 8tow Chain K

Receptor sequence
>8towK (length=37) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
KLPEAYQIFDPLVDVLPVIPLFFLALAFVWQAAVGFK
3D structure
PDB8tow Mutation-induced shift of the photosystem II active site reveals insight into conserved water channels.
ChainK
Resolution2.14 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K P28 L32 P20 L24
BS02 CLA K F31 L34 W38 Q39 F23 L26 W30 Q31
BS03 CA K D18 D22 D10 D14
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0030096 plasma membrane-derived thylakoid photosystem II
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8tow, PDBe:8tow, PDBj:8tow
PDBsum8tow
PubMed38879008
UniProtP15819|PSBK_SYNY3 Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]