Structure of PDB 8svf Chain K

Receptor sequence
>8svfK (length=278) Species: 9606 (Homo sapiens) [Search protein sequence]
GWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWI
EERRSRRDDIVNNMFFAHQLIPNSCATHALLSVLLNCSSVDLGPTLSRMK
DFTKGFSPESKGYAIGNAPELAKAHNSHARPEAFHFVSYVPITGRLFELD
GLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVV
PDRRIKYEARYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQE
GMLANLVEQNISVRRRQGVSIGRLHKQR
3D structure
PDB8svf Structural basis of histone H2A lysine 119 deubiquitination by Polycomb repressive deubiquitinase BAP1/ASXL1.
ChainK
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.4.19.12: ubiquitinyl hydrolase 1.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna K R701 G703 R266 G268
BS02 dna K R700 R701 Q702 R265 R266 Q267
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0004843 cysteine-type deubiquitinase activity
GO:0005515 protein binding
GO:0008233 peptidase activity
GO:0008234 cysteine-type peptidase activity
GO:0031490 chromatin DNA binding
GO:0140950 histone H2A deubiquitinase activity
Biological Process
GO:0000278 mitotic cell cycle
GO:0001558 regulation of cell growth
GO:0001701 in utero embryonic development
GO:0001894 tissue homeostasis
GO:0002574 thrombocyte differentiation
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006508 proteolysis
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0008283 cell population proliferation
GO:0008285 negative regulation of cell population proliferation
GO:0010467 gene expression
GO:0016579 protein deubiquitination
GO:0030154 cell differentiation
GO:0030218 erythrocyte differentiation
GO:0030223 neutrophil differentiation
GO:0030851 granulocyte differentiation
GO:0033028 myeloid cell apoptotic process
GO:0035520 monoubiquitinated protein deubiquitination
GO:0035726 common myeloid progenitor cell proliferation
GO:0036211 protein modification process
GO:0036344 platelet morphogenesis
GO:0043249 erythrocyte maturation
GO:0043363 nucleate erythrocyte differentiation
GO:0045892 negative regulation of DNA-templated transcription
GO:0050727 regulation of inflammatory response
GO:0051726 regulation of cell cycle
GO:0061484 hematopoietic stem cell homeostasis
GO:0061519 macrophage homeostasis
GO:0070050 neuron cellular homeostasis
GO:0070661 leukocyte proliferation
GO:0071108 protein K48-linked deubiquitination
GO:1900015 regulation of cytokine production involved in inflammatory response
GO:1903955 positive regulation of protein targeting to mitochondrion
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0035517 PR-DUB complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8svf, PDBe:8svf, PDBj:8svf
PDBsum8svf
PubMed37556531
UniProtQ92560|BAP1_HUMAN Ubiquitin carboxyl-terminal hydrolase BAP1 (Gene Name=BAP1)

[Back to BioLiP]