Structure of PDB 8s1p Chain K

Receptor sequence
>8s1pK (length=122) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQATPGG
VVKKGEVVKAVIVRTKSGARRSDGSYISFDENACVIIRDDKSPRGTRIFG
PVARELRENNFMKIVSLAPEVI
3D structure
PDB8s1p A role for the S4-domain containing protein YlmH in ribosome-associated quality control in Bacillus subtilis.
ChainK
Resolution1.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K M1 Q3 Q4 E5 T6 I22 K23 L25 G26 G27 S28 G29 R30 K31 V40 T42 K44 K66 R70 Y76 N82 M1 Q3 Q4 E5 T6 I22 K23 L25 G26 G27 S28 G29 R30 K31 V40 T42 K44 K66 R70 Y76 N82
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8s1p, PDBe:8s1p, PDBj:8s1p
PDBsum8s1p
PubMed38811035
UniProtP12875|RL14_BACSU Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]