Structure of PDB 8qsj Chain K

Receptor sequence
>8qsjK (length=177) Species: 9606 (Homo sapiens) [Search protein sequence]
SSFSRAPQQWATFARIWYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALS
DCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPV
AIVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKI
PKRLDEYTQEEIDAFPRLWTPPEDYRL
3D structure
PDB8qsj Structural insights into the role of GTPBP10 in the RNA maturation of the mitoribosome.
ChainK
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K G29 K30 L50 S68 K71 K75 S78 H80 P84 G85 F87 A107 Y109 G110 M111 K114 N115 L116 H117 R118 R119 G28 K29 L49 S67 K70 K74 S77 H79 P83 G84 F86 A106 Y108 G109 M110 K113 N114 L115 H116 R117 R118
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0017148 negative regulation of translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qsj, PDBe:8qsj, PDBj:8qsj
PDBsum8qsj
PubMed38042949
UniProtQ9BYD1|RM13_HUMAN Large ribosomal subunit protein uL13m (Gene Name=MRPL13)

[Back to BioLiP]