Structure of PDB 8qbl Chain K

Receptor sequence

>8qblK (length=309) Species: 469008 (Escherichia coli BL21(DE3))

SAEYLNTFRLRNLGLPVMNNLHDMSKATRISVETLRLLIYTADFRYRIYT
VEKKGPEKRMRTIYQPSRELKALQGWVLRNILDKLSSSPFSIGFEKHQSI
LNNATPHIGANFILNIDLEDFFPSLTANKVFGVFHSLGYNRLISSVLTKI
CCYKNLLPQGAPSSPKLANLICSKLDYRIQGYAGSRGLIYTRYADDLTLS
AQSMKKVVKARDFLFSIIPSEGLVINSKKTCISGPRSQRKVTGLVISQEK
VGIGREKYKEIRAKIHHIFCGKSSEIEHVRGWLSFILSVDSKSHRRLITY
ISKLEKKYG

3D structure

• PDB: 8qbl Retron-Eco1 assembles NAD + -hydrolyzing filaments that provide immunity against bacteriophages.
• Chain: K
• Resolution: 2.66 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.49: RNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	K	E35 R38 L39 Y42 F46 Q67 S69 R70 K73 I102 A129 N130 K131 F133 S138 S147 T150 K151 K156 K176 R180 Y184 R188 Y195 A196 D197 D198 K211 F215 I219 T244 G245 H280 G283 W284 F287	E33 R36 L37 Y40 F44 Q65 S67 R68 K71 I100 A127 N128 K129 F131 S136 S145 T148 K149 K154 K174 R178 Y182 R186 Y193 A194 D195 D196 K209 F213 I217 T242 G243 H278 G281 W282 F285
BS02	rna	K	K56 R63 R81 F96 E97 H99 Q100 Q161 G162 A163 P164 P167 M206 D214 T232 C233 R238 S239 Q240 R257 K261 R264 G283 S286 S290 R298	K54 R61 R79 F94 E95 H97 Q98 Q159 G160 A161 P162 P165 M204 D212 T230 C231 R236 S237 Q238 R255 K259 R262 G281 S284 S288 R296
BS03	rna	K	F217 S218 P221	F215 S216 P219
BS04	dna	K	Y6 F10 R13 N14	Y4 F8 R11 N12

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003964 RNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006974 DNA damage response
• GO:0051607 defense response to virus

External links

• PDB: RCSB:8qbl, PDBe:8qbl, PDBj:8qbl
• PDBsum: 8qbl
• PubMed: 38788717
• UniProt: P23070|RT86_ECOLX Retron Ec86 reverse transcriptase (Gene Name=ret)