Structure of PDB 8q5i Chain K

Receptor sequence

>8q5iK (length=178) Species: 5476 (Candida albicans)

PRAPRTYSKTYSVPKRPYESARLDAELKLAGEYGLKNKREIYRIGFQLSK
IRRAARDLLTRDEKDPKRLFEGNALIRRLVRIGVLSEDKMKLDYVLALKP
EDFLERRLQTQVFKLGLARSIHHARVLITQRHIAVGKQIVNIPSFTVRLD
SQKHIDFAHNSPYGGGRAGRVKRKNQGK

3D structure

• PDB: 8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy
• Chain: K
• Resolution: 2.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	P2 R3 P5 R6 T7 Y8 S9 K10 T11 V14 K16 R17 P18 Y19 K37 N38 K39 R40 R44 S50 F71 E72 A75 R78 R79 R82 R120 S121 H124 R126 Q131 R132 H133 Q139 N142 I143 S145 F146 T147 R149 S152 P163 Y164 R168 G170 R171 V172 K173 K175 N176	P1 R2 P4 R5 T6 Y7 S8 K9 T10 V13 K15 R16 P17 Y18 K36 N37 K38 R39 R43 S49 F70 E71 A74 R77 R78 R81 R119 S120 H123 R125 Q130 R131 H132 Q138 N141 I142 S144 F145 T146 R148 S151 P162 Y163 R167 G169 R170 V171 K172 K174 N175

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:0043226 organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
• PDBsum: 8q5i
• UniProt: A0A8H6F1X2