Structure of PDB 8pp6 Chain K

Receptor sequence
>8pp6K (length=36) Species: 9606 (Homo sapiens) [Search protein sequence]
GFWDCSVCTFRNSAEAFKCSICDVRKGTSTRKPRIN
3D structure
PDB8pp6 Structural basis of the histone ubiquitination read-write mechanism of RYBP-PRC1.
ChainK
Resolution3.18 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN K C27 C30 C41 C5 C8 C19
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003712 transcription coregulator activity
GO:0003714 transcription corepressor activity
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0006915 apoptotic process
GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0043065 positive regulation of apoptotic process
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0031519 PcG protein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pp6, PDBe:8pp6, PDBj:8pp6
PDBsum8pp6
PubMed38528151
UniProtQ8N488|RYBP_HUMAN RING1 and YY1-binding protein (Gene Name=RYBP)

[Back to BioLiP]