Structure of PDB 8kab Chain K

Receptor sequence

>8kabK (length=146) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

PTYTPKAGDTTRSWYVIDASDVVLGRLASAAATLLRGKHKPTFTPNVDGG
DFVIVINADKIAVSGDKLTKKFAYRHSGYPGGLRKRTIGELLEKHPTRVV
ENAIIGMLPHNKLGRQIQKKLKVYAGPDHPHAAQQPIPFEIKQVAQ

3D structure

• PDB: 8kab Cryo-EM structures reveal the molecular mechanism of HflX-mediated erythromycin resistance in mycobacteria.
• Chain: K
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	K	P2 T3 V24 G26 R27 K39 N47 S65 K68 K72 Y75 R76 H77 S78 Y80 P81 G82 L84 R85 A104 G107 M108 H111 N112 K113 L114 R116 K120 A134 Q135 Q144 Q147	P1 T2 V23 G25 R26 K38 N46 S64 K67 K71 Y74 R75 H76 S77 Y79 P80 G81 L83 R84 A103 G106 M107 H110 N111 K112 L113 R115 K119 A133 Q134 Q143 Q146

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8kab, PDBe:8kab, PDBj:8kab
• PDBsum: 8kab
• PubMed: 39029461
• UniProt: A0QSP8|RL13_MYCS2 Large ribosomal subunit protein uL13 (Gene Name=rplM)