Structure of PDB 8j6z Chain K

Receptor sequence
>8j6zK (length=84) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
DFIGSSTNLIMVTSTTLMLFAGRFGLAPSANRKATAGLRLEARDSGLQTG
DPAGFTLADTLACGTVGHIIGVGVVLGLKNIGAI
3D structure
PDB8j6z Cryo-EM structure of the Arabidopsis thaliana photosystem I(PSI-LHCII-ST2)
ChainK
Resolution2.79 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K R69 G96 D97 P98 F101 R23 G50 D51 P52 F55
BS02 CLA K F48 M57 H114 F2 M11 H68
BS03 CLA K A67 L72 P74 L84 A21 L26 P28 L38
BS04 CLA K I115 V120 G123 I69 V74 G77
Gene Ontology
Cellular Component
GO:0005634 nucleus
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009534 chloroplast thylakoid
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8j6z, PDBe:8j6z, PDBj:8j6z
PDBsum8j6z
PubMed37936349
UniProtQ9SUI5|PSAK_ARATH Photosystem I reaction center subunit psaK, chloroplastic (Gene Name=PSAK)

[Back to BioLiP]