Structure of PDB 8iwh Chain K

Receptor sequence
>8iwhK (length=37) Species: 35128 (Thalassiosira pseudonana) [Search protein sequence]
RLPEAYVVFSPLVDVFPVIPVFFLLLAFVWQAAVGFR
3D structure
PDB8iwh Structure of a diatom photosystem II supercomplex containing a member of Lhcx family and dimeric FCPII
ChainK
Resolution2.68 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K P27 L31 P20 L24
BS02 CLA K F30 W37 Q38 F23 W30 Q31
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8iwh, PDBe:8iwh, PDBj:8iwh
PDBsum8iwh
PubMed37878698
UniProtA0T0S8|PSBK_THAPS Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]