Structure of PDB 8i0s Chain K

Receptor sequence
>8i0sK (length=46) Species: 9606 (Homo sapiens) [Search protein sequence]
RWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEG
3D structure
PDB8i0s Molecular Basis for the Activation of Human Spliceosome
ChainK
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K C202 D204 K218 F219 C9 D11 K25 F26
BS02 ZN K C211 C217 H221 C18 C24 H28
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016740 transferase activity
GO:0046872 metal ion binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006281 DNA repair
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0016567 protein ubiquitination
GO:0034247 snoRNA splicing
GO:0070100 negative regulation of chemokine-mediated signaling pathway
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0016607 nuclear speck
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8i0s, PDBe:8i0s, PDBj:8i0s
PDBsum8i0s
PubMed39068178
UniProtO15541|R113A_HUMAN E3 ubiquitin-protein ligase RNF113A (Gene Name=RNF113A)

[Back to BioLiP]