Structure of PDB 8i0r Chain K

Receptor sequence
>8i0rK (length=128) Species: 9606 (Homo sapiens) [Search protein sequence]
VVYKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGK
EDDKIYRGINNYQKYMKRKGPIRAPEHLRATVRWDYQPDICKDYKETGFC
GFGDSCKFLHDRSDYKHGWQIERELDEG
3D structure
PDB8i0r Molecular Basis for the activation of Human spliceosome
ChainK
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K K203 F213 C217 K218 F219 K92 F102 C106 K107 F108
BS02 ZN K C202 C211 C217 H221 C91 C100 C106 H110
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016740 transferase activity
GO:0046872 metal ion binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006281 DNA repair
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0016567 protein ubiquitination
GO:0034247 snoRNA splicing
GO:0070100 negative regulation of chemokine-mediated signaling pathway
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0016607 nuclear speck
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8i0r, PDBe:8i0r, PDBj:8i0r
PDBsum8i0r
PubMed39068178
UniProtO15541|R113A_HUMAN E3 ubiquitin-protein ligase RNF113A (Gene Name=RNF113A)

[Back to BioLiP]