Structure of PDB 8htz Chain K

Receptor sequence
>8htzK (length=117) Species: 562 (Escherichia coli) [Search protein sequence]
RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFA
AQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITD
VTPIPHDGCRPPKKRRV
3D structure
PDB8htz Structural insights into the decoding capability of isoleucine tRNAs with lysidine and agmatidine
ChainK
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna K H22 N28 N29 T33 G39 N40 A41 W44 T46 G48 G49 R53 K57 K87 P115 H118 X119 G120 C121 R122 P123 P124 K125 R127 R128 H10 N16 N17 T21 G27 N28 A29 W32 T34 G36 G37 R41 K45 K75 P103 H106 X107 G108 C109 R110 P111 P112 K113 R115 R116
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8htz, PDBe:8htz, PDBj:8htz
PDBsum8htz
PubMed38538915
UniProtP0A7R9|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]