Structure of PDB 8htu Chain K

Receptor sequence
>8htuK (length=81) Species: 3218 (Physcomitrium patens) [Search protein sequence]
YIGSSTNLIMVASTTLMLFAGRFGLAPSANRKSTAGLKLVDRDSGLQTGD
PAGFTATDTLACGALGHVIGVGIVLGLKATA
3D structure
PDB8htu Structural insights into the assembly and energy transfer of the Lhcb9-dependent photosystem I from moss Physcomitrium patens.
ChainK
Resolution2.87 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA K G121 L124 G72 L75
BS02 CLA K P76 S82 P27 S33
BS03 CLA K A84 L86 A35 L37
BS04 CLA K L67 F68 R71 G98 D99 P100 F103 T108 L18 F19 R22 G49 D50 P51 F54 T59
BS05 CLA K V117 G121 G125 V68 G72 G76
BS06 CLA K N56 M59 T64 H116 N7 M10 T15 H67
BS07 CLA K M66 A69 L74 P76 L86 M17 A20 L25 P27 L37
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8htu, PDBe:8htu, PDBj:8htu
PDBsum8htu
PubMed37474782
UniProtA0A2K1KU02

[Back to BioLiP]