Structure of PDB 8guj Chain K

Receptor sequence

>8gujK (length=72) Species: 9606 (Homo sapiens) [Search protein sequence]

KCDEILMEEIKDYKARLTCPCCNMRKKDAVLTKCFHVFCFECVKTRYDTR
QRKCPKCNAAFGANDFHRIYIG

3D structure

PDB

8guj Structure of the human Bre1 complex bound to the nucleosome

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

2.3.2.27: RING-type E3 ubiquitin transferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	K	C937 H939 C957 C960	C34 H36 C54 C57
BS02	ZN	K	C922 C925 C942 C945	C19 C22 C39 C42

Gene Ontology

	Molecular Function
GO:0002039	p53 binding
GO:0003682	chromatin binding
GO:0003713	transcription coactivator activity
GO:0003730	mRNA 3'-UTR binding
GO:0004842	ubiquitin-protein transferase activity
GO:0005515	protein binding
GO:0016740	transferase activity
GO:0031625	ubiquitin protein ligase binding
GO:0042393	histone binding
GO:0042802	identical protein binding
GO:0046872	metal ion binding
GO:0061630	ubiquitin protein ligase activity
GO:0140850	histone H2B C-terminal K residue ubiquitin ligase activity

	Biological Process
GO:0000209	protein polyubiquitination
GO:0006325	chromatin organization
GO:0006338	chromatin remodeling
GO:0006355	regulation of DNA-templated transcription
GO:0006511	ubiquitin-dependent protein catabolic process
GO:0007346	regulation of mitotic cell cycle
GO:0016567	protein ubiquitination
GO:0030336	negative regulation of cell migration
GO:0045893	positive regulation of DNA-templated transcription
GO:0045944	positive regulation of transcription by RNA polymerase II

External links

PDB	RCSB:8guj, PDBe:8guj, PDBj:8guj
PDBsum	8guj
PubMed	38519511
UniProt	Q5VTR2\|BRE1A_HUMAN E3 ubiquitin-protein ligase BRE1A (Gene Name=RNF20)